Invitrogen™ Human C8orf33 (aa 158-218) Control Fragment Recombinant Protein

Product Code. 30198443

Brand: Invitrogen™ RP93936

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55191 (PA5-55191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Specifications

• Accession Number: Q9H7E9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65265
• Name: Human C8orf33 (aa 158-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C8orf33; chromosome 8 open reading frame 33; UPF0488 protein C8orf33
• Common Name: C8orf33
• Gene Symbol: C8orf33
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining