Invitrogen™ Human C7orf28A (aa 24-124) Control Fragment Recombinant Protein

Artikelnummer. 30210189

missing translation for 'mfr': Invitrogen™ RP104458

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62120 (PA5-62120. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts in concert with MON1A, as a guanine exchange factor (GEF) for RAB7, promotes the exchange of GDP to GTP, converting it from an inactive GDP-bound form into an active GTP-bound form (PubMed:23084991). [UniProt]

Spezifikation

• Accession Number: P86791
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51622
• Name: Human C7orf28A (aa 24-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU022870; C25H7orf28A; C7orf28A; C7orf28B; ccz1; CCZ1 homolog, vacuolar protein trafficking and biogenesis associated; CCZ1 vacuolar protein trafficking and biogenesis associated; CCZ1 vacuolar protein trafficking and biogenesis associated homolog; CCZ1A; CCZ1B; CGI-43; H_DJ1163J12.2; H_NH0577018.2; hypothetical protein LOC393103; vacuolar fusion protein CCZ1 homolog; Vacuolar fusion protein CCZ1 homolog B; Vacuolar fusion protein CCZ1 homolog-like; zgc:55344
• Common Name: C7orf28A
• Gene Symbol: CCZ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining