Invitrogen™ Human C6orf165 (aa 168-302) Control Fragment Recombinant Protein

Product Code. 30207619

Brand: Invitrogen™ RP91090

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60860 (PA5-60860. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CFAP206 may regulate cilium motility through its role in the assembly of the axonemal radial spokes.

Specifications

• Accession Number: Q8IYR0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 154313
• Name: Human C6orf165 (aa 168-302) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700003M02Rik; AU024269; C6orf165; Cfap206; cilia and flagella associated protein 206; Cilia- and flagella-associated protein 206; dJ382I10.1; RGD1310641; RIKEN cDNA 1700003M02 gene; similar to hypothetical protein; UPF0704 protein C6orf165; UPF0704 protein C6orf165 homolog
• Common Name: C6orf165
• Gene Symbol: CFAP206
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELGTFLTLSKKDKERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAVLHVAIPATMQHIDYQLETARSQVYRYTAILEKAANDPLMRAELQPYMLKEALYNIRQYEVFLQIILSDIITGAQEVEMMTKQLGAHLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining