Invitrogen™ Human C5orf54 (aa 351-451) Control Fragment Recombinant Protein

Product Code. 30208699

Brand: Invitrogen™ RP100354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61001 (PA5-61001. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZBED8 is a protein coding gene.

Specifications

• Accession Number: Q8IZ13
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63920
• Name: Human C5orf54 (aa 351-451) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Buster3; C5orf54; Protein ZBED8; transposon-derived Buster3 transposase-like protein; ZBED8; Zinc finger BED domain-containing protein 8; zinc finger BED-type containing 8; zinc finger, BED-type containing 8
• Common Name: C5orf54
• Gene Symbol: ZBED8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITLHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining