Invitrogen™ Human C5orf33 (aa 350-441) Control Fragment Recombinant Protein

Código de producto. 30196646

missing translation for 'mfr': Invitrogen™ RP104107

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58358 (PA5-58358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial NAD(+) kinase that phosphorylates NAD(+) to yield NADP(+). Can use both ATP or inorganic polyphosphate as the phosphoryl donor. Also has weak NADH kinase activity in vitro; however NADH kinase activity is much weaker than the NAD(+) kinase activity and may not be relevant in vivo.

Especificaciones

• Accession Number: Q4G0N4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 133686
• Name: Human C5orf33 (aa 350-441) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C5orf33; DECRD; Mitochondrial NAD kinase; MNADK; NAD kinase 2, mitochondrial; NAD kinase domain containing 1; NAD kinase domain-containing protein 1, mitochondrial; NADK2; Nadkd1; RGD1306809
• Common Name: C5orf33
• Gene Symbol: NADK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining