Invitrogen™ Human C4orf32 (aa 58-90) Control Fragment Recombinant Protein

Codice prodotto. 30198156

Marca: Invitrogen™ RP103447

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64021 (PA5-64021. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C4orf32 is a protein coding gene.

Specifica

• Accession Number: Q8N8J7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 132720
• Name: Human C4orf32 (aa 58-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700063A17Rik; 5730508B09Rik; C4orf32; C80506; chromosome 4 open reading frame 32; FAM241A; hypothetical protein LOC691931; LOC691931; RIKEN cDNA 5730508B09 gene; uncharacterized protein C4orf32; uncharacterized protein C4orf32 homolog; Uncharacterized protein FAM241A
• Common Name: C4orf32
• Gene Symbol: FAM241A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining