Invitrogen™ Human C4orf23 (aa 657-745) Control Fragment Recombinant Protein

Product Code. 30194820

Brand: Invitrogen™ RP96696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61007 (PA5-61007. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable adenosyl-L-methionine (AdoMet)-dependent tRNA (uracil-O(2)-)-methyltransferase.

Specifications

• Accession Number: Q8IYL2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 152992
• Name: Human C4orf23 (aa 657-745) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310079F23Rik; C4orf23; methyltransferase like 19; methyltransferase-like protein 19; Mettl19; probable tRNA (uracil-O(2)-)-methyltransferase; RGD1308380; TRM44; TRMT44; tRNA methyltransferase 44; tRNA methyltransferase 44 homolog; tRNA methyltransferase 44 homolog (S. cerevisiae)
• Common Name: C4orf23
• Gene Symbol: TRMT44
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining