Invitrogen™ Human C3orf31 (aa 156-231) Control Fragment Recombinant Protein

Product Code. 30196775

Brand: Invitrogen™ RP104797

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111205 (PA5-111205. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Specifications

• Accession Number: Q96BW9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 132001
• Name: Human C3orf31 (aa 156-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500001M20Rik; C20H3orf31; C22H3orf31; C3orf31; CDP-DAG synthase; CDP-diacylglycerol synthase; Mitochondrial translocator assembly and maintenance protein 41 homolog; MMP37-like protein, mitochondrial; phosphatidate cytidylyltransferase, mitochondrial; RAM41; TAM41; TAM41 mitochondrial translocator assembly and maintenance homolog; TAM41, mitochondrial translocator assembly and maintenance protein, homolog; TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae); TAMM41; Unknown (protein for MGC:134188)
• Common Name: C3orf31
• Gene Symbol: TAMM41
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining