Invitrogen™ Human C3orf30 (aa 275-355) Control Fragment Recombinant Protein

Product Code. 30213220

Brand: Invitrogen™ RP109828

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144957 (PA5-144957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C3orf30 is a protein coding gene.

Specifications

• Accession Number: Q96M34
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 152405
• Name: Human C3orf30 (aa 275-355) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C3orf30; chromosome 3 open reading frame 30; Testis-specific conserved, cAMP-dependent type II Pk.-anchoring protein; Testis-specific expressed protein 55; TE x 55; TSCPA; uncharacterized protein C3orf30
• Common Name: C3orf30
• Gene Symbol: C3orf30
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYRLAGLADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining