Invitrogen™ Human C2orf44 (aa 378-457) Control Fragment Recombinant Protein

Product Code. 30210372

Brand: Invitrogen™ RP96172

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59410 (PA5-59410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDCP (WD Repeat And Coiled Coil Containing) is a Protein Coding gene. Among its related pathways are Mesodermal Commitment Pathway. [GeneCards]

Specifications

• Accession Number: Q9H6R7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80304
• Name: Human C2orf44 (aa 378-457) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A430092C04; BC068281; C2orf44; cDNA sequence BC068281; FLJ21945; PP384; RGD1563701; similar to BC068281 protein; WD repeat and coiled coil containing; WD repeat and coiled-coil-containing protein; WD repeat and coiled-coil-containing protein C2orf44; WD repeat and coiled-coil-containing protein C2orf44 homolog; WD repeat-containing protein C2orf44; WD repeat-containing protein C2orf44 homolog; WDCP
• Common Name: C2orf44
• Gene Symbol: WDCP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQIRLENTERPKGICFLTDQLLLILVGKQKLTDTTFLPSSKSDQYAISLIVREIMLEEEPSITSGESQTTYSTFSAPLNK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining