Invitrogen™ Human C2orf33 (aa 101-175) Control Fragment Recombinant Protein

Product Code. 30196910

Brand: Invitrogen™ RP108010

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67357 (PA5-67357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles. [Uniprot]

Specifications

• Accession Number: Q9GZY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56947
• Name: Human C2orf33 (aa 101-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5230400G24Rik; AD030; AD033; AI314724; C2H2orf33; C2orf33; GL004; hypothetical protein LOC393508; hypothetical protein LOC506291; MFF; mffa; Mitochondrial fission factor; mitochondrial fission factor a; mitochondrial fission factor homolog B; RGD1310230; zgc:66022
• Common Name: C2orf33
• Gene Symbol: MFF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining