Invitrogen™ Human C21orf63 (aa 165-310) Control Fragment Recombinant Protein

Product Code. 30205492

Brand: Invitrogen™ RP90413

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53370 (PA5-53370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C21orf63 encodes a protein that binds heparin.

Specifications

• Accession Number: P58658
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 59271
• Name: Human C21orf63 (aa 165-310) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700092M14Rik; 4931408A02Rik; B18; B19; C21; C21orf63; C21orf64; DC42; EVA1; EVA-1; eva-1 homolog C; eva-1 homolog C (C. elegans); EVA1C; Fam176c; family with sequence similarity 176, member C; FLJ12894; IRA1; PRED34; Protein eva-1 homolog C; protein FAM176C; RGD1307569; SUE21; TBLR1; UNQ2504/PRO5993
• Common Name: C21orf63
• Gene Symbol: EVA1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPPFDCLSYSALQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLKQKDGEYGINFDPSGSKVLRKDGILVSNSLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining