Invitrogen™ Human C21orf59 (aa 110-169) Control Fragment Recombinant Protein

Product Code. 30209311

Brand: Invitrogen™ RP95883

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55990 (PA5-55990. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of the C21orf59 protein remains unknown.

Specifications

• Accession Number: P57076
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56683
• Name: Human C21orf59 (aa 110-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C21orf48; C21orf59; CFAP298; chromosome 21 open reading frame 59; CILD26; Cilia- and flagella-associated protein 298; FBB18; Kur; prostate cancer upregulated protein 1; Protein kurly homolog; UPF0769 protein C21orf59
• Common Name: C21orf59
• Gene Symbol: C21ORF59
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining