Invitrogen™ Human C20orf12 (aa 461-556) Control Fragment Recombinant Protein

Product Code. 30181378

Brand: Invitrogen™ RP99314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63734 (PA5-63734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene contains two ankyrin repeat-encoding regions. Ankyrin repeats are tandemly repeated modules of about 33 amino acids described as L-shaped structures consisting of a beta-hairpin and two alpha-helices. Ankyrin repeats occur in a large number of functionally diverse proteins, mainly from eukaryotes, and are known to function as protein-protein interaction domains.

Specifications

• Accession Number: Q9NVP4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55184
• Name: Human C20orf12 (aa 461-556) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANKRD64; ankyrin repeat domain 64; ankyrin repeat-containing protein C20orf12; bA189K21.1; bA189K21.8; C20orf12; C20orf84; dJ568F9.2; double zinc ribbon and ankyrin repeat domains 1; double zinc ribbon and ankyrin repeat-containing protein 1; DZANK1
• Common Name: C20orf12
• Gene Symbol: DZANK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining