Invitrogen™ Human C1rLP (aa 354-427) Control Fragment Recombinant Protein

Product Code. 30205252

Brand: Invitrogen™ RP89272

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82430 (PA5-82430. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum.

Specifications

• Accession Number: Q9NZP8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51279
• Name: Human C1rLP (aa 354-427) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C1RL; C1RL1; C1r-like protein; C1r-like serine protease analog protein; C1RLP; C1r-LP; CLSPA; complement C1r subcomponent like; complement C1r subcomponent-like protein; complement C1r-like proteinase; complement component 1, r subcomponent like protein; complement component 1, r subcomponent-like
• Common Name: C1rLP
• Gene Symbol: C1RL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining