missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199807

Invitrogen™ Human C1QBP (aa 107-188) Control Fragment Recombinant Protein

Product Code. 30199807
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199807

Brand: Invitrogen™ RP93199

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55318 (PA5-55318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Replication Protein A (RPA) (also known as human single-stranded DNA binding protein, or HSSB) is involved in DNA replication, repair, and recombination. RPA from human cells is a stable heterotrimer of 70kDa, 32-34kDa, and 11-14kDa subunits (RPA70, RPA32, and RPA14 respectively). RPA is required for the SV40 large tumor antigen-catalyzed unwinding of SV40 DNA and stimulates DNA polymerase alpha and delta. RPA34 is phosphorylated at the G1/S boundary of the cell cycle or upon exposure of cells to DNA damage-inducing agents including ionizing and UV radiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07021
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 708
Name Human C1QBP (aa 107-188) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA407365; AA986492; ASF/SF2-associated protein p32; C1q globular domain-binding protein; C1QBP; complement C1q binding protein; complement component 1 Q subcomponent-binding protein, mitochondrial; complement component 1, q subcomponent binding protein; D11Wsu182e; GC1QBP; gC1qR; gC1Q-R; gC1q-R protein; glycoprotein gC1qBP; HABP1; Hyaluronan-binding protein 1; mitochondrial matrix protein p32; p32; p33; RPA; SF2AP32; SF2p32; splicing factor SF2-associated protein
Common Name C1QBP
Gene Symbol C1QBP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.