Invitrogen™ Human C1orf50 (aa 106-199) Control Fragment Recombinant Protein

Product Code. 30211246

Brand: Invitrogen™ RP94442

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56411 (PA5-56411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1orf50 is a protein coding gene.

Specifications

• Accession Number: Q9BV19
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79078
• Name: Human C1orf50 (aa 106-199) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C15H1orf50; C1orf50; chromosome 1 open reading frame 50; chromosome 15 C1orf50 homolog; uncharacterized protein C1orf50; uncharacterized protein C1orf50 homolog
• Common Name: C1orf50
• Gene Symbol: C1orf50
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining