Invitrogen™ Human C1GALT1C1 (aa 164-291) Control Fragment Recombinant Protein

Codice prodotto. 30193780

Marca: Invitrogen™ RP108717

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lacks the galactosyltransferase activity itself, but instead acts as a molecular chaperone required for the folding, stability and full activity of the core 1 beta1,3-galactosyltransferase 1. Mutations in this gene have been associated with Tn syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.

Specifica

• Accession Number: Q96EU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29071
• Name: Human C1GALT1C1 (aa 164-291) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500002I11Rik; AB030184; beta 1,3-galactosyltransferase 2; beta1,3-galactosyltransferase 2; C1GALT1 specific chaperone 1; C1galt1c1; C1GALT1-specific chaperone 1; C1GALT2; C1Gal-T2; C38H2-L1; C38H2-like protein 1; C81205; core 1 beta1,3-galactosyltransferase 2; core 1 beta3-galactosyltransferase-specific molecular chaperone; core 1 beta3-Gal-T2; core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 2; COSMC; HSPC067; mC1Gal-T2; MST143; MSTP143; RGD1311230; TNPS; UNQ273/PRO310
• Common Name: C1GALT1C1
• Gene Symbol: C1GALT1C1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining