Invitrogen™ Human C19orf48 Control Fragment Recombinant Protein

Product Code. 30182499

Brand: Invitrogen™ RP99147

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59814 (PA5-59814. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The C19orf48 gene, located on chromosome 19q13, encodes a protein involved in various biological processes, including its role as a minor histocompatibility antigen recognized by CD8+ T cells. This gene has been implicated in oncogenesis due to its elevated expression in certain cancer types, such as breast cancer, where it has been associated with poor prognosis. The non-synonymous single-nucleotide polymorphisms within C19orf48 contribute to differential T-cell recognition in donor and recipient cells, highlighting its significance in immune responses. Additionally, C19orf48 has been linked with SNORD88C, a small nucleolar RNA (snoRNA) that guides methylation of rRNA, further illustrating its involvement in cellular proliferation and metastasis.

Specifications

• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84798
• Name: Human C19orf48 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C19orf48; chromosome 19 open reading frame 48; multidrug resistance-related protein; Uncharacterized protein C19orf48
• Common Name: C19orf48
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining