Invitrogen™ Human C17orf96 (aa 2-38) Control Fragment Recombinant Protein

Product Code. 30209799

Brand: Invitrogen™ RP106610

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65930 (PA5-65930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Elongin BC and Polycomb repressive complex 2-associated protein (EPOP) also know as C17ORF96 is a scaffold protein that serves as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex. It is required to fine tune the transcriptional status of polycomb group (PcG) target genes in embryonic stem cells (ESCs). C17ORF96 also plays a key role in genomic regions that display both active and repressive chromatin properties in pluripotent stem cells by sustaining low level expression of PcG target genes. It acts by recruiting the elongin BC complex, thereby restricting excessive activity of the PRC2/EED-EZH2 complex. C17ORF96 also has interacts with USP7 and promotes deubiquitination of H2B at promoter sites.

Specifications

• Accession Number: A6NHQ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100170841
• Name: Human C17orf96 (aa 2-38) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409164; AI413509; AW539173; C17orf96; C9H17orf96; chromosome 17 open reading frame 96; CUNH17orf96; E13; E130012A19Rik; elongin BC and polycomb repressive complex 2 associated protein; elongin BC and Polycomb repressive complex 2-associated protein; Embryonic stem cell-specific PRC2 subunit p48; EPOP; ES cell-specific PRC2 subunit p48; esPRC2p48; hypothetical protein LOC691153; LOC691153; proline rich 28; Proline-rich protein 28; PRR28; RIKEN cDNA E130012A19 gene; uncharacterized protein C17orf96; uncharacterized protein C17orf96 homolog; Uncharacterized protein ENSP00000317905
• Common Name: C17orf96
• Gene Symbol: EPOP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining