Invitrogen™ Human C17orf85 (aa 147-256) Control Fragment Recombinant Protein

Product Code. 30193806

Brand: Invitrogen™ RP89980

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53033 (PA5-53033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Associates with NCBP1/CBP80 to form an alternative cap-binding complex (CBC) which plays a key role in mRNA export. NCBP3 serves as adapter protein linking the capped RNAs (m7GpppG-capped RNA) to NCBP1/CBP80. Unlike the conventional CBC with NCBP2 which binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus, the alternative CBC with NCBP3 does not bind snRNA and associates only with mRNA thereby playing a role in only mRNA export. The alternative CBC is particularly important in cellular stress situations such as virus infections and the NCBP3 activity is critical to inhibit virus growth.

Spécification

• Accession Number: Q53F19
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55421
• Name: Human C17orf85 (aa 147-256) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200014J11Rik; C11H17orf85; C130061O14Rik; C17orf85; C19H17orf85; C78393; C9H17orf85; CTD-3195I5.1; CTD-3195I5.5; ELG; ELG protein; HSA277841; Ncbp3; nuclear cap binding subunit 3; nuclear cap-binding protein subunit 3; Protein ELG; RGD1308139; RIKEN cDNA 1200014J11 gene; similar to RIKEN cDNA 1200014J11; uncharacterized protein C17orf85 homolog
• Common Name: C17orf85
• Gene Symbol: NCBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining