Invitrogen™ Human C17orf49 (aa 95-170) Control Fragment Recombinant Protein

Product Code. 30212358

Brand: Invitrogen™ RP93367

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55083 (PA5-55083. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of chromatin complexes such as the MLL1/MLL and NURF complexes.

Specifications

• Accession Number: Q8IXM2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124944
• Name: Human C17orf49 (aa 95-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610010K14Rik; 1110020A23Rik; AL033328; AU045833; BAP18; BPTF associated protein of 18 kDa; BPTF-associated protein of 18 kDa; C17orf49; Chromatin complexes subunit BAP18; chromosome 17 open reading frame 49; HEPIS; human embryo lung cellular protein interacting with SARS-CoV nsp-10; MLL1/MLL complex subunit C17orf49; MLL1/MLL complex subunit C17orf49 homolog; RIKEN cDNA 0610010K14 gene
• Common Name: C17orf49
• Gene Symbol: C17orf49
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining