Invitrogen™ Human C17orf47 Isoform 7 Control Fragment Recombinant Protein

Product Code. 30213491

Brand: Invitrogen™ RP93472

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55846 (PA5-55846. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C17orf47 Isoform 7 refers to a variant of the C17orf47 gene, located on chromosome 17 (17p13.3). This gene encodes a protein that plays a role in various cellular processes, though its exact functions are still being explored. The gene has several splice variants, with Isoform 7 being one of them, potentially impacting its functional properties. C17orf47 is expressed in multiple tissues, and its expression may vary depending on the tissue type, suggesting a role in tissue-specific cellular functions.

Specifications

• Accession Number: O43236
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5414
• Name: Human C17orf47 Isoform 7 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C17orf47; Chromosome 17 open reading frame 47; Septin 4
• Common Name: C17orf47 Isoform 7
• Gene Symbol: SEPTIN4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSAYPETKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHVTVPSVSEGSHKSSMFVTPEPIYKQQTQKPPEITYMSQGPTPRYPELSQKPSIHAEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining