Invitrogen™ Human C16orf93 (aa 239-324) Control Fragment Recombinant Protein

Product Code. 30181160

Brand: Invitrogen™ RP98591

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61206 (PA5-61206. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C16orf93, also named as CCDC189, is a coiled-coil domain-containing protein which has four isoforms with MW 38 kDa, 34 kDa, 12 kDa and 20 kDa.

Specifications

• Accession Number: A1A4V9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90835
• Name: Human C16orf93 (aa 239-324) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C16orf93; CCDC189; coiled-coil domain containing 189; coiled-coil domain-containing protein 189
• Common Name: C16orf93
• Gene Symbol: CCDC189
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining