Invitrogen™ Human C14orf80 (aa 153-241) Control Fragment Recombinant Protein

Product Code. 30181961

Brand: Invitrogen™ RP97615

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58637 (PA5-58637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C14orf80 may play a role in counteracting perturbation of actin filaments, such as after treatment with the actin depolymerizing microbial metabolite Chivosazole F.

Specifications

• Accession Number: Q86SX3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283643
• Name: Human C14orf80 (aa 153-241) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C14orf80; chromosome 14 open reading frame 80; TEDC1; Tubulin epsilon and delta complex protein 1; uncharacterized protein C14orf80
• Common Name: C14orf80
• Gene Symbol: TEDC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQVSGAGAAQNLDLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining