Invitrogen™ Human C14orf4 (aa 540-584) Control Fragment Recombinant Protein

Product Code. 30210928

Brand: Invitrogen™ RP105177

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66377 (PA5-66377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May contribute to the control of female reproductive function. May play a role in gene transcription by transactivating GNRH1 promoter and repressing PENK promoter.

Specifications

• Accession Number: Q9H1B7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64207
• Name: Human C14orf4 (aa 540-584) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C14orf4; EAP1; enhanced at puberty 1; enhanced (at puberty protein 1; interferon regulatory factor 2 binding protein like; interferon regulatory factor 2 binding protein-like; interferon regulatory factor 2-binding protein-like; IRF2BPL; KIAA1865; My039; Probable E3 ubiquitin-protein ligase IRF2BPL)
• Common Name: C14orf4
• Gene Symbol: IRF2BPL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining