Invitrogen™ Human C13orf15 (aa 28-61) Control Fragment Recombinant Protein

Product Code. 30196044

Brand: Invitrogen™ RP107280

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66622 (PA5-66622. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation.

Specifications

• Accession Number: Q9H4X1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28984
• Name: Human C13orf15 (aa 28-61) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002H23Rik; bA157L14.2; C13orf15; regulator of cell cycle; regulator of cell cycle RGCC; Response gene to complement 32 protein; Rgc32; RGC-32; Rgcc
• Common Name: C13orf15
• Gene Symbol: RGCC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining