Invitrogen™ Human C12orf29 Control Fragment Recombinant Protein

Product Code. 30180481

Brand: Invitrogen™ RP97732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58873 (PA5-58873. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C12orf29 (Chromosome 12 Open Reading Frame 29) is a Protein Coding gene. Diseases associated with C12orf29 include Senior-Loken Syndrome 6 and Meckel Syndrome, Type 4. [GeneCards]

Specifications

• Accession Number: Q8N999
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91298
• Name: Human C12orf29 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C12orf29; chromosome 12 open reading frame 29; CLO29; DKFZp313K0436; DKFZp434N2030; DKFZp686L04169; FLJ38158; MGC102978; uncharacterized protein C12orf29
• Common Name: C12orf29
• Gene Symbol: C12orf29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining