missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human C11orf79 (aa 22-86) Control Fragment Recombinant Protein

Product Code. 30205445
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30205445 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30205445 Supplier Invitrogen™ Supplier No. RP97445

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58904 (PA5-58904. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SDHAF2, also named asC11orf79, SDHAF2 and SDH5, is a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. SDHAF2 has been shown to be mutated in patients with paragangliomas, also known as familial non-chromaffin paragangliomas type 2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NX18
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54949
Name Human C11orf79 (aa 22-86) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610038F07Rik; AA407634; AW049997; C11orf79; HAMAP-Rule:MF_03057}; hSDH5; PGL2; RGD1309216; SDH assembly factor 2; SDH assembly factor 2 {ECO:0000255; SDH5; SDHAF2; succinate dehydrogenase assembly factor 2, mitochondrial; succinate dehydrogenase assembly factor 2, mitochondrial {ECO:0000255; succinate dehydrogenase complex assembly factor 2; succinate dehydrogenase subunit 5, mitochondrial; succinate dehydrogenase subunit 5, mitochondrial {ECO:0000255
Common Name C11orf79
Gene Symbol Sdhaf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.