missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human C10orf90 (aa 2-94) Control Fragment Recombinant Protein

Artikelnummer. 30212542
Klik for at se tilgængelige muligheder
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30212542

Brand: Invitrogen™ RP109464

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140170 (PA5-140170. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q96M02
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 118611
Name Human C10orf90 (aa 2-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (E2-independent) E3 ubiquitin-conjugating enzyme FATS; bA422P15.2; C10orf90; Centrosomal protein C10orf90; chromosome 10 open reading frame 90; E2/E3 hybrid ubiquitin-protein ligase FATS; FATS; Fragile-site associated tumor suppressor homolog
Common Name C10orf90
Gene Symbol C10orf90
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.