Invitrogen™ Human C10orf32 (aa 53-106) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30196050	100 μL	100µL

Product Code. 30196050 Supplier Invitrogen™ Supplier No. RP109951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145165 (PA5-145165. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C10orf32 (chromosome 10 open reading frame 32) is a 105 amino acid protein that belongs to the UPF0693 family. The gene encoding C10orf32 maps to human chromosome 10, which spans nearly 135 million base pairs, makes up approximately 4.5% of total DNA in cells and encodes nearly 1,200 genes. Several protein-coding genes, including those that encode for chemokines, cadherins, excision repair proteins, early growth response factors (Egrs) and fibroblast growth receptors (FGFRs), are located on chromosome 10. Defects in some of the genes that map to chromosome 10 are associated with Charcot-Marie-Tooth disease, Jackson-Weiss syndrome, Usher syndrome, nonsyndromatic deafness, Wolman's syndrome, Cowden syndrome, multiple endocrine neoplasia type 2 and porphyria.

Specifications

• Accession Number: Q96B45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 119032
• Name: Human C10orf32 (aa 53-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010012O05Rik; 4930569L17Rik; AI413851; AI467257; BLOC-1 related complex subunit 7; BLOC-1-related complex subunit 7; BORCS7; C10orf32; diaskedin; RGD1311783; RIKEN cDNA 2010012O05 gene; similar to RIKEN cDNA 2010012O05; UPF0693 protein C10orf32; UPF0693 protein C10orf32 homolog
• Common Name: C10orf32
• Gene Symbol: BORCS7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining