missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human C10orf32 (aa 53-106) Control Fragment Recombinant Protein

Product Code. 30196050
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196050 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196050 Supplier Invitrogen™ Supplier No. RP109951

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145165 (PA5-145165. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C10orf32 (chromosome 10 open reading frame 32) is a 105 amino acid protein that belongs to the UPF0693 family. The gene encoding C10orf32 maps to human chromosome 10, which spans nearly 135 million base pairs, makes up approximately 4.5% of total DNA in cells and encodes nearly 1,200 genes. Several protein-coding genes, including those that encode for chemokines, cadherins, excision repair proteins, early growth response factors (Egrs) and fibroblast growth receptors (FGFRs), are located on chromosome 10. Defects in some of the genes that map to chromosome 10 are associated with Charcot-Marie-Tooth disease, Jackson-Weiss syndrome, Usher syndrome, nonsyndromatic deafness, Wolman's syndrome, Cowden syndrome, multiple endocrine neoplasia type 2 and porphyria.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96B45
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 119032
Name Human C10orf32 (aa 53-106) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010012O05Rik; 4930569L17Rik; AI413851; AI467257; BLOC-1 related complex subunit 7; BLOC-1-related complex subunit 7; BORCS7; C10orf32; diaskedin; RGD1311783; RIKEN cDNA 2010012O05 gene; similar to RIKEN cDNA 2010012O05; UPF0693 protein C10orf32; UPF0693 protein C10orf32 homolog
Common Name C10orf32
Gene Symbol BORCS7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.