Invitrogen™ Human C1 inhibitor (aa 322-433) Control Fragment Recombinant Protein

Product Code. 30208907

Brand: Invitrogen™ RP93694

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1-inhibitor (C1INH) functions as a regulator of the activation of the classical complement pathway and of the contact activation system of kinin generation and coagulation. Its primary biologically relevant target proteinases are C1r, C1s, coagulation factors XIa and XIIa, and plasma kallikrein. C1-inhibitor consists of one polypeptide chain and has a molecular mass of ∽104 kDa. Serum concentration has been determined to 180 μg/mL.

Specifications

• Accession Number: P05155
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 710
• Name: Human C1 inhibitor (aa 322-433) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C1 esterase inhibitor; C1 Inh; C1 inhibitor; C1IN; C1Inh; C1-inhibiting factor; C1nh; complement component 1 inhibitor; complement component 1 inhibitor (angioedema, hereditary); esterase inhibitor; factor XIIa inhibitor; HAE1; HAE2; IC1; Plasma protease C1 inhibitor; serine (or cysteine) peptidase inhibitor, clade G, member 1; serine (or cysteine) proteinase inhibitor, clade G (C1 inhibitor), member 1; serine (or cysteine) proteinase inhibitor, clade G (C1 inhibitor), member 1, (angioedema, hereditary); serine (or cysteine) proteinase inhibitor, clade G, member 1; serine/cysteine proteinase inhibitor clade G member 1; serpin family G member 1; serpin G1; serpin peptidase inhibitor clade G member 1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1, (angioedema, hereditary); serpin peptidase inhibitor, clade G, member 1; SERPING1; XIIaINH
• Common Name: C1 inhibitor
• Gene Symbol: SERPING1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining