Invitrogen™ Human c-Myc (aa 286-360) Control Fragment Recombinant Protein

Product Code. 30194791

Brand: Invitrogen™ RP107507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The c-Myc protein is a 62 kDa transcription factor that is encoded by the c-Myc gene on human chromosome 8q24. c-Myc is commonly activated in a variety of tumor cells and plays an important role in cellular proliferation, differentiation, apoptosis and cell cycle progression. The phosphorylation of c-Myc has been investigated and previous studies have suggested a functional association between phosphorylation at Thr58/Ser62 by glycogen synthase kinase 3, cyclin dependent kinase, ERK2 and C-Jun N terminal Kinase (JNK) in cell proliferation and cell cycle regulation. Studies have shown that c-Myc is essential for vasculogenesis and angiogenesis in tumor development, which distributes blood throughout the cells. The c-myc oncogene (p62 c-myc) is involved in the control of normal cellular proliferation and differentiation, and the deregulated expression of c-Myc induces apoptosis in different cell types. Antibodies against c-myc epitopes recognize overexpressed proteins containing Myc epitope tag fused to either amino- or carboxy-termini of targeted proteins. c-Myc-, N-Myc- and L-Myc-encoded proteins function in cell proliferation, differentiation and neoplastic disease. Amplification of the c-Myc gene has been found in several types of human tumors including lung, breast and colon carcinomas, while the N-Myc gene has been found amplified in neuroblastomas. Translocation of the c-myc locus on chromosome 8 to the immunoglobulin loci on chromosome 14 (heavy chain); 2 (delta light chain); or 22 (light chain) is described in Burkitts lymphoma and other B-cell lymphoproliferative conditions. An aberrant expression of the c-myc gene occurs in tumors of different origins such as colorectal, gastric, gallbladder, hepatic, mammary, ovarian, endometrial, head and neck, pulmonary, prostatic, thyroidal, oral, ocular, nasopharyngeal, endocrine, as well as hematopoietic neoplasms.

Specifications

• Accession Number: P01106
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4609
• Name: Human c-Myc (aa 286-360) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU016757; Avian myelocytomatosis viral (v-myc) oncogene homolog; avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; class E basic helix-loop-helix protein 39; cmyc; c-Myc; c-myc epitope tag; c-myc proto-oncogene; mMyc; MRTL; Myc; Myc protein; Myc proto-oncogene protein; MYC proto-oncogene, bHLH transcription factor; Myc2; MYCC; myc-related translation/localization regulatory factor; myelocytomatosis oncogene; myelocytomatosis viral oncogene homolog; Niard; Nird; Proto-oncogene c-Myc; RNCMYC; Transcription factor p64; v-myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene-like protein
• Common Name: c-Myc
• Gene Symbol: MYC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining