Invitrogen™ Human c-Met Control Fragment Recombinant Protein

Product Code. 30198191

Brand: Invitrogen™ RP106648

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MET (cMET) is a receptor-like tyrosine kinase whose dysregulation has been linked to many types of human malignancies. After activation of the ligand, MET interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, and STAT3. There interactions lead to the activation of signaling cascades including RAS-ERK, PI3, kinase-AKT, and PLCgamma-PKC. MET plays a role in embryonic development including gastrulation, development of muscles and neurons, angiogenesis, and kidney formation. It also plays a role in adults including wound healing, organ regeneration, and tissue remodeling. MET has been linked to cancers including gastric, renal, and breast; therefore, making it a target for cancer therapeutics and diagnostic testing.

Specifications

• Accession Number: P08581
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4233
• Name: Human c-Met Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI838057; AUTS9; bHLHe59; CG1705; CG1705-PA; CG1705-PB; cmet; c-met; c-met proto-oncogene; c-Met receptor tyrosine kinase; c-Met/HGF receptor; D249; DFNB97; Dmel\CG1705; Dmel_CG1705; DmMet; EC 2.7.10.1; Hepatocyte growth factor receptor; HGF; HGF receptor; HGF receptor c-Met; HGF/SF receptor; HGFR; HGF-SF receptor; juvenile hormone resistance; met; met proto-oncogene; met proto-oncogene (hepatocyte growth factor receptor); met proto-oncogene tyrosine kinase; MET proto-oncogene, receptor tyrosine kinase; Met/Met1; Met; protein tyrosin kinase; methoprene tolerant; Methoprene-tolerant; Methoprene-tolerant protein; Met-PA; Met-PB; Mett; oncogene MET; Par4; Proto-oncogene c-Met; RCCP2; resistance (1) juvenile H; resistance to juvenile hormone; Rst(1)JH; sc MET; scatter factor receptor; SF receptor; soluble c met; tyrosine-protein kinase Met
• Common Name: c-Met
• Gene Symbol: MET
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining