missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human c-Kit (aa 684-764) Control Fragment Recombinant Protein

Product Code. 30196491
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196491

Brand: Invitrogen™ RP107919

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIT (c-KIT) is a proto-oncogene and a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). KIT was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. KIT together with its ligand regulates growth and activation of a variety of hemopoietic and non-hemopoietic cells. Mutations in KIT are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Recently, deregulation of the KIT receptor TK by the prevalent activation loop mutation D816V has served as a focal point in therapeutic strategies aimed at curbing neoplastic mast cell growth. c-Kit is expressed in hematopoietic stem cells, germ cells, mast cells and gastrointestinal tract cajal cells. Upon binding of its ligand stem cell factor (SCF), c-kit dimerizes, resulting in receptor activation and autophosphorylation of various tyrosine residues including tyrosine 703 located on the cytoplasmic domain of the receptor. This modification allows docking of Grb2 and activation of the Ras/ERK signaling pathway. SCF/c-kit can activate multiple downstream signaling pathways including PI3K, PLC-gamma and JAK/STAT. c-kit receptor activation is essential for hematopoiesis, stem cell maintenance and gametogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10721
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3815
Name Human c-Kit (aa 684-764) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias belly-spot; Bs; CD117; ckit; C-Kit; c-KIT gene1; c-kit protein; c-kit proto-oncogene protein; c-kit receptor; c-kit receptor tyrosine kinase; dominant spotting; Dominant white spotting; Fdc; Gsfsco1; Gsfsco5; Gsfsow3; KIT; kit oncogene; KIT proto-oncogene receptor tyrosine kinase; KIT proto-oncogene, receptor tyrosine kinase; mast cell growth factor receptor; mast/stem cell growth factor receptor; mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; protein kinase; proto-oncogene c-Kit; proto-oncogene tyrosine-protein kinase Kit; receptor tyrosine kinase c-kit; receptor tyrosine kinase type III; SCFR; SCO1; SCO5; Sl; soluble KIT variant 1; SOW3; spotted sterile male; Ssm; Steel Factor Receptor; Tr-kit; tyrosine kinase receptor; tyrosine kinase receptor c-KIT; tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; W
Common Name c-Kit (CD117)
Gene Symbol KIT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.