missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human c-Jun (aa 94-166) Control Fragment Recombinant Protein

Product Code. 30199243
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199243

Brand: Invitrogen™ RP110204

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144942 (PA5-144942. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-Jun is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P05412
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3725
Name Human c-Jun (aa 94-166) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Activator protein 1; AH119; AP1; AP-1; Avian sarcoma virus 17 (v-jun) oncogene homolog; cjun; c-Jun; c-jun transcription factor; enhancer-binding protein AP1; I79_009953; immediate early; JUN; Jun A; Jun activation domain binding protein; Jun oncogene; jun proto-oncogene; Jun proto-oncogene, AP-1 transcription factor subunit; Junc; JUND; p39; proto-oncogene c-Jun; Rjg-9; transcription factor; transcription factor AP-1; V-jun avian sarcoma virus 17 oncogene homolog; v-jun sarcoma virus 17 oncogene homolog
Common Name c-Jun
Gene Symbol JUN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.