Invitrogen™ Human c-Fos (aa 72-210) Control Fragment Recombinant Protein

Product Code. 30195304

Brand: Invitrogen™ RP88926

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FBJ murine osteosarcoma viral oncogene homolog is commonly known as Cellular protooncogene Fos (c-Fos). It belongs to the fos transcription factor family and is encoded by the C-FOS gene located on chromosome 14. c-Fos heterodimerizes with c-Jun to form the Activator Protein -1 (AP-1) transcription factor which regulates transcription of several genes that play an important role in cellular signal transduction, cell proliferation and differentiation. c-Fos has been shown to be phosphorylated by various stimuli including growth factors and insulin at atleast seven different sites. The best known upstream kinase for phosphorylation at Threonine 232 is ERK MAPK which regulates localization of c-Fos to the nucleus and is thus important for c-Fos induced transcriptional activity.

Specifications

• Accession Number: P01100
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2353
• Name: Human c-Fos (aa 72-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: activator protein 1; AP-1; cellular oncogene c-fos; cellular oncogene fos; cFos; C-FOS; c-fos oncogene; c-fos protooncogene protein; D12Rfj1; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); FBJ murine osteosarcoma viral oncogene homolog; FBJ murine osteosarcoma viral oncogene homolog B; FBJ osteosarcoma oncogene; FBJ osteosarcoma oncogene B; FBJ osteosarcoma viral oncogene isoform deltaFosb-2; FOS; Fos proto-oncogene, AP-1 trancription factor subunit; Fos proto-oncogene, AP-1 transcription factor subunit; Fosb; FosB proto-oncogene, AP-1 transcription factor subunit; fra-2; G0/G1 switch regulatory protein 7; G0S7; I79_009428; p55; protein fosB; proto-oncogene cFOS; proto-oncogene c-Fos; proto-oncogene protein c-fos; v-fos FBJ murine osteosarcoma viral oncogene homolog
• Common Name: c-Fos
• Gene Symbol: FOS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining