missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human C/EBP delta (aa 212-269) Control Fragment Recombinant Protein

Product Code. 30212440
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212440

Brand: Invitrogen™ RP107587

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111625 (PA5-111625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C/EBP delta are CCAAT enhancer binding proteins (CEBPs), a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. At least six members of the family have been isolated and characterized to date (CEBP alpha to CEBP zeta). CEBPD is a leucine zipper (LZ) DNA-binding protein that regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. CEBPD is an important transcriptional activator in the regulation of genes involved in immune and inflammatory responses and has been reported to possess many tumor suppressor-like properties.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49716
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1052
Name Human C/EBP delta (aa 212-269) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C EBP; c/EBP delta; C/EBPd; C/EBPdelta; C/EBP-delta; c/EBP-related protein 3; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBPD; Celf; CRP3; NF-IL6-beta; Nuclear factor NF-IL6-beta; transcription factor CELF
Common Name C/EBP delta
Gene Symbol CEBPD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.