Invitrogen™ Human C/EBP delta (aa 212-269) Control Fragment Recombinant Protein

Product Code. 30212440

Brand: Invitrogen™ RP107587

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111625 (PA5-111625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C/EBP delta are CCAAT enhancer binding proteins (CEBPs), a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. At least six members of the family have been isolated and characterized to date (CEBP alpha to CEBP zeta). CEBPD is a leucine zipper (LZ) DNA-binding protein that regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. CEBPD is an important transcriptional activator in the regulation of genes involved in immune and inflammatory responses and has been reported to possess many tumor suppressor-like properties.

Spezifikation

• Accession Number: P49716
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1052
• Name: Human C/EBP delta (aa 212-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C EBP; c/EBP delta; C/EBPd; C/EBPdelta; C/EBP-delta; c/EBP-related protein 3; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBPD; Celf; CRP3; NF-IL6-beta; Nuclear factor NF-IL6-beta; transcription factor CELF
• Common Name: C/EBP delta
• Gene Symbol: CEBPD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining