missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human c-Abl (aa 612-694) Control Fragment Recombinant Protein

Product Code. 30195763
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195763 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195763 Supplier Invitrogen™ Supplier No. RP95232

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ABL1 proto-oncogene encodes a cytoplasmic and nuclear protein tyrosine kinase that has been implicated in processes of cell differentiation, cell division, cell adhesion, and stress response. Activity of c-Abl protein is negatively regulated by its SH3 domain, and deletion of the SH3 domain turns c-Abl into an oncogene. The DNA-binding activity of the ubiquitously expressed ABL1 tyrosine kinase is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function for c-Abl. In chronic myelogenous leukemia and a subset of acute lymphoblastic leukemias, the c-Abl proto oncogene undergoes a (9;22) chromosomal translocation producing a novel rearranged chromosome (the Philadelphia chromosome). As the result of the fusion of c-Abl sequences from chromosome 9 to the Bcr gene on chromosome 22. The c-Abl oncogene was initially identified as the viral transforming gene of Abelson murine leukemia virus (A-MuLV). c-ABL potentially regulates DNA repair by activating the proapoptotic pathway when the DNA damage is too severe to be repaired.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00519
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25
Name Human c-Abl (aa 612-694) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Abelson murine leukemia oncogene; Abelson murine leukemia viral (v-abl) oncogene homolog 1; abelson murine leukemia viral oncogene homolog 1; Abelson tyrosine-protein kinase 1; Abl; Abl 1 antib; ABL proto-oncogene 1, non-receptor tyrosine kinase; Abl1; ABL2; ABLL; AI325092; ARG; B30; bcr/abl; bcr/c-abl oncogene protein; c-ABL; c-abl oncogene 1, non-receptor tyrosine kinase; c-abl oncogene 1, receptor tyrosine kinase; c-ABL1; E430008G22Rik; JTK7; p150; Proto-oncogene c-Abl; proto-oncogene tyrosine-protein kinase ABL1; RP11-83J21.1; Tyrosine kinase ARG; tyrosine-protein kinase ABL1; v-abl; v-abl Abelson murine leukemia oncogene 1; v-abl Abelson murine leukemia viral oncogene 1; v-abl Abelson murine leukemia viral oncogene homolog 1
Common Name c-Abl
Gene Symbol ABL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.