Invitrogen™ Human BZRAP1 (aa 1167-1259) Control Fragment Recombinant Protein

Product Code. 30194862

Brand: Invitrogen™ RP93210

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55235 (PA5-55235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: O95153
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9256
• Name: Human BZRAP1 (aa 1167-1259) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: benzodiazapine receptor (peripheral) associated protein 1; benzodiazapine receptor peripheral-associated protein 1; benzodiazepine receptor (peripheral) associated protein 1; BZRAP1; KIAA0612; PBR-IP; Peripheral benzodiazepine receptor-interacting protein; peripheral-type benzodiazepine receptor-associated protein 1; PRAX1; PRAX-1; RBP1; RIMBP1; RIM-BP1; RIMS-binding protein 1; TSPO associated protein 1; TSPOAP1; TSPO-associated protein 1
• Common Name: BZRAP1
• Gene Symbol: TSPOAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTASTSTLGEKDPGPAAPSLAKQEAEWTAGEACPASSSTQGARAQQAPNTEMCQGGDPGSGLRPRAEKEDTAELGVHLVNSLVDHGRNSDLSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining