Invitrogen™ Human BXDC1 (aa 196-286) Control Fragment Recombinant Protein

Product Code. 30211118

Brand: Invitrogen™ RP95043

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57286 (PA5-57286. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPF2 is a protein coding gene involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.

Specifications

• Accession Number: Q9H7B2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84154
• Name: Human BXDC1 (aa 196-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810470K21Rik; AU040229; AU043242; bA397G5.4; brix domain containing 1; brix domain-containing protein 1; Brix domain-containing protein 1-like protein; BXDC1; homolog of Rpf2; hypothetical protein LOC406587; ik:tdsubc_1a3; MNCb-4285; ribosomal processing factor 2 homolog; ribosome biogenesis protein RPF2 homolog; Ribosome production factor 2 homolog; ribosome production factor 2 homolog (S. cerevisiae); RP11-397G5.1; Rpf2; Unknown (protein for MGC:134144); wu:fe17d08; wu:fj16d06; xx:tdsubc_1a3; zgc:77150
• Common Name: BXDC1
• Gene Symbol: Rpf2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining