Invitrogen™ Human BTN1A1 (aa 427-525) Control Fragment Recombinant Protein

Product Code. 30207783

Brand: Invitrogen™ RP90178

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82413 (PA5-82413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BTN1A1 (Butyrophilin) is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.

Specifications

• Accession Number: Q13410
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 696
• Name: Human BTN1A1 (aa 427-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bK14H9.2 (butyrophilin, subfamily 1, member A1); BT; BTN; BTN1; Btn1a1; butyrophilin precursor; butyrophilin subfamily 1 member A1; butyrophilin, subfamily 1, member A1
• Common Name: BTN1A1
• Gene Symbol: BTN1A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining