Invitrogen™ Human Btk (aa 206-351) Control Fragment Recombinant Protein

Product Code. 30208175

Brand: Invitrogen™ RP95403

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bruton tyrosine kinase (BTK) is a cytoplasmic tyrosine kinase belonging to the SRC-related TEC subfamily of tyrosine kinases. Mutations in the BTK gene have been linked to severe developmental blocks in human B-cell ontogeny and immunodeficiency disorders. It has recently been shown to interact with members of the toll-like receptor (TLR) family such as TLR4, 6, 8, and 9. The TLRs are critical molecules in both the innate and adaptive immunity and can recognize diverse microbial pathogens. BTK has also been shown to interact with key proteins involved in TLR4 signal transduction such as MyD88, TIRAP, and IRAK, but not TRAF-6, suggesting that BTK is involved in lipopolysaccharide signal transduction.

Specifications

• Accession Number: Q06187
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 695
• Name: Human Btk (aa 206-351) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: agammaglobulinaemia tyrosine kinase; agammaglobulinemia tyrosine kinase; AGM x 1; AI528679; AT; ATK; B-cell progenitor kinase; BPK; Bruton agammaglobulinemia tyrosine kinase; Bruton tyrosine kinase; Bruton's tyrosine kinase; BTK; dominant-negative kinase-deficient Brutons tyrosine kinase; IMD1; Kinase EMB; MGC126261; MGC126262; OTTHUMP00000023677; PSCTK1; RP1-164F3.2; truncated Bruton agammaglobulinemia tyrosine kinase; tyrosine-protein kinase BTK; Tyrosine-protein kinase BTK (Brutons tyrosine kinase) (Agammaglobulinaemia tyrosine kinase) (ATK) (B cell progenitor kinase) (BPK) (Kinase EMB); tyrosine-protein kinase BTK isoform (lacking exon 13 to 17); tyrosine-protein kinase BTK isoform (lacking exon 14); xid; XLA; X-linked immune deficiency
• Common Name: BTK
• Gene Symbol: BTK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining