missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BTG2 (aa 43-144) Control Fragment Recombinant Protein

Product Code. 30199270
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199270

Brand: Invitrogen™ RP102129

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51705 (PA5-51705. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P78543
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7832
Name Human BTG2 (aa 43-144) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA959598; Agl; An; an-1; APRO1; B cell translocation gene 2, anti-proliferative; B-cell translocation gene 2; B-cell translocation gene 2, anti-proliferative; BTG anti-proliferation factor 2; BTG family member 2; BTG family, member 2; BTG2; cell surface alloantigen; Early induced gene B-cell translocation gene 2; nerve growth factor-inducible anti-proliferative; NGF-inducible anti-proliferative protein PC3; NGF-inducible anti-proliferative putative secreted protein; NGF-inducible protein TIS21; Pc3; pheochromacytoma cell-3; protein BTG2; Tis21
Common Name BTG2
Gene Symbol BTG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.