Invitrogen™ Human BTBD1 (aa 29-78) Control Fragment Recombinant Protein

Product Code. 30207657

Brand: Invitrogen™ RP108750

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139775 (PA5-139775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The C-terminus of BTBD1 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9H0C5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 53339
• Name: Human BTBD1 (aa 29-78) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190005H08Rik; BTB (POZ) domain containing 1; BTB domain containing 1; BTB/POZ domain-containing protein 1; Btbd1; C15orf1; glucose signal-repressing protein; Gsrp; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; NS5ATP8
• Common Name: BTBD1
• Gene Symbol: BTBD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining