Invitrogen™ Human BSSP4 (aa 32-85) Control Fragment Recombinant Protein

Product Code. 30197354

Brand: Invitrogen™ RP101091

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61901 (PA5-61901. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Specifications

• Accession Number: Q9GZN4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64063
• Name: Human BSSP4 (aa 32-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4733401N09Rik; brain-specific serine protease 4; BSP-2; BSSP4; BSSP-4; hBSSP-4; MGC9599; prosemin; protease, serine 22; protease, serine S1 family member 22; protease, serine, 22; PRSS22; Prss26; Serine protease 22; serine protease 26; SP001LA; Tryptase epsilon; UNQ302/PRO343
• Common Name: BSSP4
• Gene Symbol: PRSS22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining