Invitrogen™ Human BSND (aa 138-223) Control Fragment Recombinant Protein

Product Code. 30201937

Brand: Invitrogen™ RP108219

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84463 (PA5-84463. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BSND encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear.

Specifications

• Accession Number: Q8WZ55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7809
• Name: Human BSND (aa 138-223) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BART; Bartter syndrome, infantile, with sensorineural deafness (Barttin); barttin; barttin CLCNK type accessory beta subunit; barttin CLCNK-type chloride channel accessory beta subunit; Bsnd; deafness, autosomal recessive 73; DFNB73
• Common Name: BSND
• Gene Symbol: BSND
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining