missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BRUNOL4 (aa 314-369) Control Fragment Recombinant Protein

Product Code. 30196987
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196987

Brand: Invitrogen™ RP108723

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139747 (PA5-139747. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BZC1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56853
Name Human BRUNOL4 (aa 314-369) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230070D14Rik; Brul4; Bruno -like 4; brunol4; BRUNOL-4; bruno-like 4, RNA binding protein; bruno-like protein 4; C130060B05Rik; celf4; CELF-4; CUGBP; CUG-BP and ETR-3 like factor 4; CUG-BP- and ETR-3-like factor 4; CUGBP Elav-like family member 4; CUGBP, Elav-like family member 4; LYST-interacting protein LIP9; RNA-binding protein BRUNOL4; RNA-binding protein BRUNOL-4; zgc:92761
Common Name BRUNOL4
Gene Symbol CELF4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.