Invitrogen™ Human BRSK1 (aa 268-318) Control Fragment Recombinant Protein

Product Code. 30207028

Brand: Invitrogen™ RP103421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84515 (PA5-84515. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRSK1 (SAD1) is a serine/threonine kinase, and is a UV-induced DNA damage checkpoint kinase. BRSK1 is unbiquitously expressed, with highest levels of expression in the brain and testes. Similar to its yeast homolog, BRSK1 is thought to be involved in stress-induced cell cycle arrest. Overexpression of this protein leads to the G2/M arrest in HeLa S2 cells and UV-induced G2/M arrest could be partially abrogated by reduced expression of BRSK1 through the use of siRNA, indicating its role in DNA damage checkpoint function. More recently, it has been shown that both BRSK1 and the related protein BRSK2 are required for mammalian neuronal polarization. While BRSK1- and BRSK2-null mice were viable, double-mutant mice died within two hours of birth. Neurons from these mice showed uniformly-sized neurites as opposed to the normal long axon and multiple shorter dendrites. These neurites also displayed both axonal and dendritic markers. At least two isoforms of BRSK1 are known to exist.

Specifications

• Accession Number: Q8TDC3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84446
• Name: Human BRSK1 (aa 268-318) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BR serine/threonine kinase 1; BR serine/threonine-protein kinase 1; Brain-selective kinase 1; brain-specific serine/threonine-protein kinase 1; Brsk1; Gm1100; hSAD1; KIAA1811; protein kinase SAD1A; RGD1563268; SAD1; SAD1 homolog; SAD1 kinase; SAD1A; SADB; SAD-B; SadB kinase short isoform; serine/threonine kinase SADB; serine/threonine kinase SAD-B; serine/threonine-protein kinase BRSK1; Serine/threonine-protein kinase SAD-B; synapses of Amphids Defective homolog 1
• Common Name: BRSK1
• Gene Symbol: Brsk1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining