Invitrogen™ Human BRPF1 (aa 752-859) Control Fragment Recombinant Protein

Product Code. 30211777

Brand: Invitrogen™ RP100748

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51909 (PA5-51909. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRPF1 (peregrin) is a component of the MOZ/MORF complex. This complex has histone H3 acetyltransferase activity. BRPF1 preferentially mediates histone H3-K23 acetylation and positively regulates the transcription of RUNX1 and RUNX2. Mutations affecting the gene can result in intellectual developmental disorder with dysmorphic facies and ptosis.

Specifications

• Accession Number: P55201
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7862
• Name: Human BRPF1 (aa 752-859) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833438B11Rik; 4930540D11Rik; BR140; bromodomain and PHD finger containing 1; bromodomain and PHD finger containing, 1; bromodomain and PHD finger-containing protein 1; bromodomain-containing protein, 140 kD; Brpf1; Brpf2; Peregrin; Protein Br140
• Common Name: BRPF1
• Gene Symbol: BRPF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining